HPA012896

C17orf80 antibody from Sigma-Aldrich
FLJ20721, HLC-8, MIG3, SPEP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012896, RRID:AB_1850766
Product name
Anti-C17orf80 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012896
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf80 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGD
LKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDG
VKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEK
NTESLILSLKMSSLGKIQVM
Storage
-20C
Provider Type Product Number
- No reagents -