HPA012897

PTRH2 antibody from Sigma-Aldrich
BIT1, CFAP37, CGI-147, PTH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012897, RRID:AB_1855949
Product name
Anti-PTRH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012897
Antibody type
Polyclonal
Antigen
Peptidyl-tRNA hydrolase 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLK
MGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYC
GQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDA
GRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL
Storage
-20C
Provider Type Product Number
- No reagents -