Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005286-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005286-A01, RRID:AB_461947
- Product name
- PIK3C2A polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PIK3C2A.
- Antigen sequence
MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRK
TKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSV
LSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLT
AATYL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The SH3 domain of postsynaptic density 95 mediates inflammatory pain through phosphatidylinositol-3-kinase recruitment.
Arbuckle MI, Komiyama NH, Delaney A, Coba M, Garry EM, Rosie R, Allchorne AJ, Forsyth LH, Bence M, Carlisle HJ, O'Dell TJ, Mitchell R, Fleetwood-Walker SM, Grant SG
EMBO reports 2010 Jun;11(6):473-8
EMBO reports 2010 Jun;11(6):473-8
No comments: Submit comment
No validations: Submit validation data