HPA000592

EMID1 antibody from Sigma-Aldrich
EMI5, EMU1, hEmu1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000592
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000592, RRID:AB_1078737
Product name
Anti-EMID1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000592
Antibody type
Polyclonal
Antigen
EMI domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSC
PGSSYRTVVRPTYKVMYKIVTAREWRCCPGHSGVS
CEEVAASSASLEPMWSGSTMRRMALRPTAFSGCLN
CSKVSELTERLKVLEAKMTMLTVIEQPVPPTPAT
Storage
-20C
Provider Type Product Number
- No reagents -