HPA012628

GALNT1 antibody from Sigma-Aldrich
GalNAc-T1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012628
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012628, RRID:AB_1849439
Product name
Anti-GALNT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012628
Antibody type
Polyclonal
Antigen
Polypeptide N-acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQ
EKMKEMFKINQFNLMASEMIALNRSLPD
Storage
-20C
Provider Type Product Number
- No reagents -