HPA057610

YARS2 antibody from Atlas Antibodies
CGI-04, FLJ13995, mt-TyrRS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA057610
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA057610, RRID:AB_2683483
Product name
Anti-YARS2
Provider product page
Atlas Antibodies - HPA057610
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FTVLDNSAWYQKQHLVDFLAAVGGHFRMGTLLSRQ
SVQLRLKSPEGMSLAEFFYQVLQAYDFYYLFQRYG
CRVQLGGSDQLGNIMSGYEFINKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -