HPA012852

ASGR1 antibody from Sigma-Aldrich
CLEC4H1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012852, RRID:AB_1845080
Product name
Anti-ASGR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012852
Antibody type
Polyclonal
Antigen
Asialoglycoprotein receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQ
LEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAA
LQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADA
DNYCRLEDAHLVVVTSWE
Storage
-20C
Provider Type Product Number
- No reagents -