H00055003-B01P

PAK1IP1 antibody from Abnova Corporation
bA421M1.5, FLJ20624, hPIP1, MAK11, PIP1, WDR84

Antibody data

Product number
H00055003-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055003-B01P, RRID:AB_1578381
Product name
PAK1IP1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055003-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PAK1IP1 protein.
Antigen sequence
MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVAD
FTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMK
KKIEHGALVHHSGTITCLKFYGNRHLISGAEDGLI
CIWDAKKWECLKSIKAHKGQVTFLSIHPSGKLALS
VGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSPR
GEQYVVIIQNKIDIYQLDTASISGTVTNEKRISSV
KFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHE
NRVKDMFSFEIPEHHVIVSASSDGFIKMWKLEQDK
KVPPSLLCEINTNARLTCLGVWLDKVADMKESLPP
AAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTK
KRGLTGDSKKATKESGLISTKKRKMVEMLEKKRKK
KKIKTMQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -