Antibody data
- Antibody Data
- Antigen structure
- References [15]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001070-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001070-M01, RRID:AB_464016
- Product name
- CETN3 monoclonal antibody (M01), clone 3E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CETN3.
- Antigen sequence
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFE
LFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL
KDYDREATGKITFEDFNEVVTDWILERDPH- Isotype
- IgG
- Antibody clone number
- 3E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Opposing effects of pericentrin and microcephalin on the pericentriolar material regulate CHK1 activation in the DNA damage response.
CENP-W plays a role in maintaining bipolar spindle structure.
Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.Na.
Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair.
Abnormal centrosomal structure and duplication in Cep135-deficient vertebrate cells.
DNA damage-induced centrosome amplification occurs via excessive formation of centriolar satellites.
FAM190A deficiency creates a cell division defect.
The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content.
Loss of centrioles causes chromosomal instability in vertebrate somatic cells.
Disruption of mouse Cenpj, a regulator of centriole biogenesis, phenocopies Seckel syndrome.
C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis.
A primary microcephaly protein complex forms a ring around parental centrioles.
Defective nucleotide excision repair with normal centrosome structures and functions in the absence of all vertebrate centrins.
TPCK targets elements of mitotic spindle and induces cell cycle arrest in prometaphase.
CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response.
Antonczak AK, Mullee LI, Wang Y, Comartin D, Inoue T, Pelletier L, Morrison CG
Oncogene 2016 Apr 14;35(15):2003-10
Oncogene 2016 Apr 14;35(15):2003-10
CENP-W plays a role in maintaining bipolar spindle structure.
Kaczmarczyk A, Sullivan KF
PloS one 2014;9(10):e106464
PloS one 2014;9(10):e106464
Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.Na.
Mäki-Jouppila JH, Laine LJ, Rehnberg J, Narvi E, Tiikkainen P, Hukasova E, Halonen P, Lindqvist A, Kallio L, Poso A, Kallio MJ
Molecular cancer therapeutics 2014 May;13(5):1054-66
Molecular cancer therapeutics 2014 May;13(5):1054-66
Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair.
Dantas TJ, Daly OM, Conroy PC, Tomas M, Wang Y, Lalor P, Dockery P, Ferrando-May E, Morrison CG
PloS one 2013;8(7):e68487
PloS one 2013;8(7):e68487
Abnormal centrosomal structure and duplication in Cep135-deficient vertebrate cells.
Inanç B, Pütz M, Lalor P, Dockery P, Kuriyama R, Gergely F, Morrison CG
Molecular biology of the cell 2013 Sep;24(17):2645-54
Molecular biology of the cell 2013 Sep;24(17):2645-54
DNA damage-induced centrosome amplification occurs via excessive formation of centriolar satellites.
Löffler H, Fechter A, Liu FY, Poppelreuther S, Krämer A
Oncogene 2013 Jun 13;32(24):2963-72
Oncogene 2013 Jun 13;32(24):2963-72
FAM190A deficiency creates a cell division defect.
Patel K, Scrimieri F, Ghosh S, Zhong J, Kim MS, Ren YR, Morgan RA, Iacobuzio-Donahue CA, Pandey A, Kern SE
The American journal of pathology 2013 Jul;183(1):296-303
The American journal of pathology 2013 Jul;183(1):296-303
The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content.
Schaub JR, Stearns T
Molecular biology of the cell 2013 Feb;24(4):453-64
Molecular biology of the cell 2013 Feb;24(4):453-64
Loss of centrioles causes chromosomal instability in vertebrate somatic cells.
Sir JH, Pütz M, Daly O, Morrison CG, Dunning M, Kilmartin JV, Gergely F
The Journal of cell biology 2013 Dec 9;203(5):747-56
The Journal of cell biology 2013 Dec 9;203(5):747-56
Disruption of mouse Cenpj, a regulator of centriole biogenesis, phenocopies Seckel syndrome.
McIntyre RE, Lakshminarasimhan Chavali P, Ismail O, Carragher DM, Sanchez-Andrade G, Forment JV, Fu B, Del Castillo Velasco-Herrera M, Edwards A, van der Weyden L, Yang F, Sanger Mouse Genetics Project, Ramirez-Solis R, Estabel J, Gallagher FA, Logan DW, Arends MJ, Tsang SH, Mahajan VB, Scudamore CL, White JK, Jackson SP, Gergely F, Adams DJ
PLoS genetics 2012;8(11):e1003022
PLoS genetics 2012;8(11):e1003022
C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis.
Conroy PC, Saladino C, Dantas TJ, Lalor P, Dockery P, Morrison CG
Cell cycle (Georgetown, Tex.) 2012 Oct 15;11(20):3769-78
Cell cycle (Georgetown, Tex.) 2012 Oct 15;11(20):3769-78
A primary microcephaly protein complex forms a ring around parental centrioles.
Sir JH, Barr AR, Nicholas AK, Carvalho OP, Khurshid M, Sossick A, Reichelt S, D'Santos C, Woods CG, Gergely F
Nature genetics 2011 Oct 9;43(11):1147-53
Nature genetics 2011 Oct 9;43(11):1147-53
Defective nucleotide excision repair with normal centrosome structures and functions in the absence of all vertebrate centrins.
Dantas TJ, Wang Y, Lalor P, Dockery P, Morrison CG
The Journal of cell biology 2011 Apr 18;193(2):307-18
The Journal of cell biology 2011 Apr 18;193(2):307-18
TPCK targets elements of mitotic spindle and induces cell cycle arrest in prometaphase.
Fabian Z, Fearnhead HO
Biochemical and biophysical research communications 2010 May 14;395(4):458-64
Biochemical and biophysical research communications 2010 May 14;395(4):458-64
CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response.
Barr AR, Kilmartin JV, Gergely F
The Journal of cell biology 2010 Apr 5;189(1):23-39
The Journal of cell biology 2010 Apr 5;189(1):23-39
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CETN3 monoclonal antibody (M01), clone 3E6 Western Blot analysis of CETN3 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CETN3 expression in transfected 293T cell line by CETN3 monoclonal antibody (M01), clone 3E6.Lane 1: CETN3 transfected lysate(19.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CETN3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol