HPA012853

FBN2 antibody from Sigma-Aldrich
CCA, DA9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012853, RRID:AB_1848588
Product name
Anti-FBN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012853
Antibody type
Polyclonal
Antigen
Fibrillin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGI
GTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSR
PGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFS
PGVGGAGVGAGGQGPIITGLTILNQ
Storage
-20C
Provider Type Product Number
- No reagents -