Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079603-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079603-M03, RRID:AB_530111
- Product name
- LASS4 monoclonal antibody (M03), clone 7D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LASS4.
- Antigen sequence
ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTE
GHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDR
PQLTKKFCEASWR- Isotype
- IgG
- Antibody clone number
- 7D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LASS4 monoclonal antibody (M03), clone 7D5 Western Blot analysis of LASS4 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody (M03), clone 7D5.Lane 1: LASS4 transfected lysate(46.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LASS4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LASS4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol