HPA011404

B4GALNT3 antibody from Sigma-Aldrich
B4GalNac-T3, FLJ16224, FLJ40362
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011404
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011404, RRID:AB_1845242
Product name
Anti-B4GALNT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011404
Antibody type
Polyclonal
Antigen
N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N- acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETHNKCFYQENAYYQDRFSFQEYIKIDQPEKQGLE
QPGFEENLLEESQYGEVAEETPASNNQNARMLEGR
QTPASTLEQDATDYRLRSLRKLLAQPREGLLAPFS
KRNSTASFPGRTSHIPVQQPEKRKQKPSPEPSQDS
PHSD
Storage
-20C
Provider Type Product Number
- No reagents -