WH0121227M2

LRIG3 antibody from Sigma-Aldrich
FLJ90440, KIAA3016
ELISA
Recommended by provider

Antibody data

Product number
WH0121227M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0121227M2, RRID:AB_1842323
Product name
Monoclonal Anti-LRIG3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0121227M2
Antibody type
Monoclonal
Antigen
LRIG3 (NP_700356, a.a. 1020-1120) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYS
SFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERT
DFQEENHICTFKQTLENYRTPNFQSYDLDT* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -