H00121227-A01

LRIG3 antibody from Abnova Corporation
FLJ90440, KIAA3016
No application information provided.

Antibody data

Product number
H00121227-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00121227-A01, RRID:AB_462948
Product name
LRIG3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00121227-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant LRIG3.
Antigen sequence
LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYS
SFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERT
DFQEENHICTFKQTLENYRTPNFQSYDLDT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -