H00121227-M02

LRIG3 antibody from Abnova Corporation
FLJ90440, KIAA3016
No application information provided.

Antibody data

Product number
H00121227-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00121227-M02, RRID:AB_606538
Product name
LRIG3 monoclonal antibody (M02), clone 4D5
Provider product page
Abnova Corporation - H00121227-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LRIG3.
Antigen sequence
LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYS
SFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERT
DFQEENHICTFKQTLENYRTPNFQSYDLDT
Isotype
IgG
Antibody clone number
4D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -