Antibody data
Product number H00004117-M02 - Provider product page
Provider Abnova Corporation
Proper citation Abnova Corporation Cat#H00004117-M02, RRID:AB_714768 Product name MAK monoclonal antibody (M02), clone 4E9 Antibody type Monoclonal Description Mouse monoclonal antibody raised against a partial recombinant MAK. Antigen sequence PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSG RRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGV FKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Isotype IgG Antibody clone number 4E9 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
MAK protein structure - H00004117-M02 shown in red.
Supportive validation
Submitted by
Abnova Corporation (provider)
Main image
Experimental details
MAK monoclonal antibody (M02), clone 4E9 Western Blot analysis of MAK expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
Submitted by
Abnova Corporation (provider)
Main image
Experimental details
Western Blot analysis of MAK expression in transfected 293T cell line by MAK monoclonal antibody (M02), clone 4E9.Lane 1: MAK transfected lysate(52.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
Submitted by
Abnova Corporation (provider)
Main image
Experimental details
Detection limit for recombinant GST tagged MAK is approximately 0.3ng/ml as a capture antibody.
Validation comment
Sandwich ELISA (Recombinant protein)
Protocol
Protocol
Supportive validation
Submitted by
Abnova Corporation (provider)
Main image
Experimental details
Immunofluorescence of monoclonal antibody to MAK on HeLa cell. [antibody concentration 10 ug/ml]
Validation comment
Immunofluorescence
Protocol
Protocol