SAB1401196

IFNA10 antibody from MilliporeSigma / Merck KGaA
IFN-alphaC
No application information provided.

Antibody data

Product number
SAB1401196
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-IFNA10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401196
Antibody type
Polyclonal
Antigen
IFNA10 (NP_002162.1, 1 a.a. ~ 189 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNR
RALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQ
FQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLL
EKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI
LAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSL
SFSTNLQKRLRRKD
Storage
-20C