Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503549 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon, alpha 5 (IFNA5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVR
KYFQR ITLYLTEKKY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
Janssen R, Bont L, Siezen CL, Hodemaekers HM, Ermers MJ, Doornbos G, van 't Slot R, Wijmenga C, Goeman JJ, Kimpen JL, van Houwelingen HC, Kimman TG, Hoebee B
The Journal of infectious diseases 2007 Sep 15;196(6):826-34
The Journal of infectious diseases 2007 Sep 15;196(6):826-34
No comments: Submit comment
No validations: Submit validation data