Antibody data

Product number
ABIN503549
Provider
antibodies-online
Product name
anti-Interferon, alpha 5 (IFNA5) (Middle Region) antibody
Provider product page
antibodies-online - ABIN503549
Antibody type
Polyclonal
Antigen
The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5
Description
Affinity Purified
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVR
KYFQR ITLYLTEKKY
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -