HPA046039

KLHL9 antibody from Atlas Antibodies
FLJ13568, KIAA1354
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA046039
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046039, RRID:AB_2679514
Product name
Anti-KLHL9
Provider product page
Atlas Antibodies - HPA046039
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFR
FDPRYNKWMQVASLNE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -