HPA059901

KLHL9 antibody from Atlas Antibodies
FLJ13568, KIAA1354

Antibody data

Product number
HPA059901
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059901, RRID:AB_2684155
Product name
Anti-KLHL9
Provider product page
Atlas Antibodies - HPA059901
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDP
EKDEWHKVFDLPESLGGIRACTLTV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -