HPA012545

ILDR2 antibody from Sigma-Aldrich
C1orf32
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012545, RRID:AB_2126894
Product name
Anti-ILDR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012545
Antibody type
Polyclonal
Antigen
Transmembrane and immunoglobulin domain-containing protein C1orf32 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKE
DRESFRHSQPRSKSEMLSRKNFATGVPAVSMDELA
AFADSYGQRPRRADGNSHEARGGSRFERSESRAHS
GFYQDDSLEEYYGQRSRSREPLTDADR
Storage
-20C
Provider Type Product Number
- No reagents -