Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009230-B02P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009230-B02P, RRID:AB_1579462
- Product name
- RAB11B purified MaxPab mouse polyclonal antibody (B02P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human RAB11B protein.
- Antigen sequence
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNE
FNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ
ERYRRITSAYYRGAVGALLVYDIAKHLTYENVERW
LKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEAR
AFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRI
VSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPN
KLQCCQNL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Acidosis-induced V-ATPase trafficking in salivary ducts is initiated by cAMP/PKA/CREB pathway via regulation of Rab11b expression.
Rab11b and its effector Rip11 regulate the acidosis-induced traffic of V-ATPase in salivary ducts.
The Rab11 pathway is required for influenza A virus budding and filament formation.
Oehlke O, Schlosshardt C, Feuerstein M, Roussa E
The international journal of biochemistry & cell biology 2012 Aug;44(8):1254-65
The international journal of biochemistry & cell biology 2012 Aug;44(8):1254-65
Rab11b and its effector Rip11 regulate the acidosis-induced traffic of V-ATPase in salivary ducts.
Oehlke O, Martin HW, Osterberg N, Roussa E
Journal of cellular physiology 2011 Mar;226(3):638-51
Journal of cellular physiology 2011 Mar;226(3):638-51
The Rab11 pathway is required for influenza A virus budding and filament formation.
Bruce EA, Digard P, Stuart AD
Journal of virology 2010 Jun;84(12):5848-59
Journal of virology 2010 Jun;84(12):5848-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAB11B expression in transfected 293T cell line (H00009230-T01) by RAB11B MaxPab polyclonal antibody.Lane 1: RAB11B transfected lysate(23.98 KDa).Lane 2: Non-transfected lysate.