H00055757-D01P

UGGT2 antibody from Abnova Corporation
FLJ10873, FLJ11485, HUGT2, MGC117360, MGC150689, MGC87276, UGCGL2

Antibody data

Product number
H00055757-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055757-D01P, RRID:AB_10616345
Product name
UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00055757-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human UGCGL2 protein.
Antigen sequence
MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSV
TAHLAAKWPETPLLLEASEFMAEESNEKFWQFLET
VQELAIYKQTESDYSYYNLILKKAGQFLDNLHINL
LKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVV
IHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFP
TNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEE
ILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKA
LDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -