HPA047955

UGGT2 antibody from Atlas Antibodies
FLJ10873, FLJ11485, HUGT2, MGC117360, MGC150689, MGC87276, UGCGL2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA047955
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047955, RRID:AB_2680222
Product name
Anti-UGGT2
Provider product page
Atlas Antibodies - HPA047955
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GEMGIVSNGRFLGPLDEDFYAEDFYLLEKITFSNL
GEKIKGIVENMGINANNMSDFIMKVDALMSSVPKR
ASRYDVTFLRENHSVIKTNPQENDMFFNV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -