HPA010775

NECTIN4 antibody from Atlas Antibodies
LNIR, nectin-4, PRR4, PVRL4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010775
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010775, RRID:AB_1079720
Product name
Anti-NECTIN4
Provider product page
Atlas Antibodies - HPA010775
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLH
SKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAV
QADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSL
NPGPAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -