HPA011812

ERVFRD-1 antibody from Sigma-Aldrich
envFRD, ERVFRDE1, HERV-FRD, HERV-W/FRD, syncytin-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011812, RRID:AB_1857702
Product name
Anti-AL136139.6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011812
Antibody type
Polyclonal
Antigen
HERV-FRD_6p24.1 provirus ancestral Env polyprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQGTLLDKSSRFCQGRPSSCSTRNFWFRPADYNQC
LQISNLSSTAEWVLLDQTRNSLFWENKTKGANQSQ
TPCVQVLAGMTIATSYLGISAVSEFFGTSLTPLFH
FHISTCLKTQGAFYICGQSIHQCLPSNWTGTC
Storage
-20C
Provider Type Product Number
- No reagents -