HPA027398
antibody from Atlas Antibodies
Targeting: USH1C
AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA027398 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA027398, RRID:AB_10601775
- Product name
- Anti-USH1C
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPV
PLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRK
YEEGFDPYSM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomic analysis of the enterocyte brush border.
McConnell RE, Benesh AE, Mao S, Tabb DL, Tyska MJ
American journal of physiology. Gastrointestinal and liver physiology 2011 May;300(5):G914-26
American journal of physiology. Gastrointestinal and liver physiology 2011 May;300(5):G914-26
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines Caco-2 and PC-3 using Anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN