H00010083-M07
antibody from Abnova Corporation
Targeting: USH1C
AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010083-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010083-M07, RRID:AB_1112346
- Product name
- USH1C monoclonal antibody (M07), clone 2B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant USH1C.
- Antigen sequence
FTPEQIMGKDVRLLRIKKEGSLDLALEGGVDSPIG
KVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTD
YTLAEADAALQKAWNQGGDWIDLVVAVCPPKEYDD
ELTFF- Isotype
- IgG
- Antibody clone number
- 2B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of USH1C expression in transfected 293T cell line by USH1C monoclonal antibody (M07), clone 2B3.Lane 1: USH1C transfected lysate (Predicted MW: 60.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of USH1C transfected lysate using anti-USH1C monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with USH1C monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol