HPA027492

USH1C antibody from Sigma-Aldrich
AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027492
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027492, RRID:AB_10601898
Product name
Anti-USH1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027492
Antibody type
Polyclonal
Antigen
Usher syndrome 1C (autosomal recessive, severe) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQ
LTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCG
LFISHLI
Storage
-20C
Provider Type Product Number
- No reagents -