HPA010718
FCGR2A antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative
CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Eligible for validation within the Antibodypedia Validation Initiative
- Western blot
Enhanced validation
- Immunohistochemistry
- Enhanced validation
Antibody data
- Antibody Data
- Knockdown Reagents [0]
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010718
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010718, RRID:AB_888586
- Product name
- Anti-FCGR2A
- Provider product page
- Atlas Antibodies - HPA010718
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNN
DYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVN
SNN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Provider | Type | Product Number |
|---|---|---|
| - No reagents - | ||
