HPA010718

FCGR2A antibody from Atlas Antibodies
CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010718
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010718, RRID:AB_888586
Product name
Anti-FCGR2A
Provider product page
Atlas Antibodies - HPA010718
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNN
DYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVN
SNN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -