HPA010718

FCGR2A antibody from Sigma-Aldrich
CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010718
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010718, RRID:AB_1078463
Product name
Anti-FCGR2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010718
Antibody type
Polyclonal
Antigen
Low affinity immunoglobulin gamma Fc region receptor II-a precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNN
DYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVN
SNN
Storage
-20C
Provider Type Product Number
- No reagents -