HPA010778

FAM163A antibody from Atlas Antibodies
C1orf76, MGC16664
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010778
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010778, RRID:AB_889067
Product name
Anti-FAM163A
Provider product page
Atlas Antibodies - HPA010778
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACS
SQALDGRGSLAPLTSEPCSQPCGVAASHCTTCSPY
SSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPS
LKLAAPQSYPVTWPGSGREAFTNPRAIST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -