HPA010778

FAM163A antibody from Sigma-Aldrich
C1orf76, MGC16664
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010778
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010778, RRID:AB_1079368
Product name
Anti-FAM163A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010778
Antibody type
Polyclonal
Antigen
UPF0417 protein C1orf76 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACS
SQALDGRGSLAPLTSEPCSQPCGVAASHCTTCSPY
SSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPS
LKLAAPQSYPVTWPGSGREAFTNPRAIST
Storage
-20C
Provider Type Product Number
- No reagents -