Antibody data

Product number
H00029767-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029767-B02P, RRID:AB_1581405
Product name
TMOD2 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00029767-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TMOD2 protein.
Antigen sequence
MALPFQKELEKYKNIDEDELLGKLSEEELKQLENV
LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLL
MYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPI
ETRKEEKVTLDPELEEALASASDTELYDLAAVLGV
HNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPV
FEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNI
PIPTLREFAKALETNTHVKKFSLAATRSNDPVAIA
FADMLKVNKTLTSLNIESNFITGTGILALVEALKE
NDTLTETKIDNQRQQLGTAVEMEIAQMLEENSRIL
KFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADR
R
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -