HPA029190

CST9 antibody from MilliporeSigma / Merck KGaA
CLM, CTES7A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029190
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029190, RRID:AB_10602804
Product name
Anti-CST9 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029190
Antibody type
Polyclonal
Antigen
cystatin 9 (testatin) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGNNKIVQDPMFFATVEFALNTFNVQSKEEHAYRL
LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRK
FEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCM
GCGV
Storage
-20C
Provider Type Product Number
- No reagents -