HPA010725

C1orf43 antibody from Sigma-Aldrich
DKFZp586G1722, NICE-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010725, RRID:AB_1078341
Product name
Anti-C1orf43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010725
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIK
YEPQLLADDDARLLQLETQGNQSCYNYLYRMKALD
AIRTS
Storage
-20C
Provider Type Product Number
- No reagents -