Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001469-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001469-B01P, RRID:AB_1138132
- Product name
- CST1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human CST1 protein.
- Antigen sequence
MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIY
NADLNDEWVQRALHFAISEYNKATKDDYYRRPLRV
LRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCA
FHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQE
S- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cystatin SN upregulation in patients with seasonal allergic rhinitis.
Upregulation of the cysteine protease inhibitor, cystatin SN, contributes to cell proliferation and cathepsin inhibition in gastric cancer.
Imoto Y, Tokunaga T, Matsumoto Y, Hamada Y, Ono M, Yamada T, Ito Y, Arinami T, Okano M, Noguchi E, Fujieda S
PloS one 2013;8(8):e67057
PloS one 2013;8(8):e67057
Upregulation of the cysteine protease inhibitor, cystatin SN, contributes to cell proliferation and cathepsin inhibition in gastric cancer.
Choi EH, Kim JT, Kim JH, Kim SY, Song EY, Kim JW, Kim SY, Yeom YI, Kim IH, Lee HG
Clinica chimica acta; international journal of clinical chemistry 2009 Aug;406(1-2):45-51
Clinica chimica acta; international journal of clinical chemistry 2009 Aug;406(1-2):45-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CST1 expression in transfected 293T cell line (H00001469-T01) by CST1 MaxPab polyclonal antibody.Lane 1: CST1 transfected lysate(15.51 KDa).Lane 2: Non-transfected lysate.