HPA026522

MCMDC2 antibody from MilliporeSigma / Merck KGaA
C8orf45, FLJ25692
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026522
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026522, RRID:AB_10603453
Product name
Anti-C8orf45 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026522
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf45 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRVHVPGATESATIRNDFLCNLCASSLQEDRKFRV
LGDKQIVEIIATKALRAFQGYSNNQPFRFQSLTIF
LRDESVNKMNI
Storage
-20C
Provider Type Product Number
- No reagents -