HPA011222

GALNT2 antibody from Atlas Antibodies
GalNAc-T2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA011222
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011222, RRID:AB_1849446
Product name
Anti-GALNT2
Provider product page
Atlas Antibodies - HPA011222
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNC
LDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVK
HMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIE
GNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQ
QWKFTLNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -