H00285600-B01P

KIAA0825 antibody from Abnova Corporation
C5orf36, DKFZp686F0372, MGC34713

Antibody data

Product number
H00285600-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00285600-B01P, RRID:AB_1577252
Product name
MGC34713 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00285600-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC34713 protein.
Antigen sequence
MDWDDEYSHNSFDLHCLLNSFPGDLEFEQIFSDID
EKIEQNAASIKHCIKEIQSEINKQCPGVQLQTTTD
CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLK
NEQNQEEMTLDLLWDLSCHSSVSFPSTLSGTSFHF
LSRTSLHSVEDNSSMDVKSMWDDIRLHLRRFLVSK
LQSHNEINNSQQKILLKKQCLQQLLFLYPESEVII
KYQNIQNKLLANLLWNCFPSYNRDSNLDVIAHGYQ
STMLKLYSVIKEDFNTLCEILAPSSMVKFIKETYL
DTVTEEMAKFLENFCELQFRENAVRVVKTSKSSSK
HRGAVHALG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -