HPA018022

TTC13 antibody from Sigma-Aldrich
FLJ22584
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018022
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018022, RRID:AB_2211524
Product name
Anti-TTC13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018022
Antibody type
Polyclonal
Antigen
Tetratricopeptide repeat protein 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EERTQLYHAEIDALYKDLTAKGKVLILSSEFGEAD
AVCNLILSLVYYFYNLMPLSRGSSVIAYSVIVGAL
MASGKEVAGKIPKGKLVDFEAMTAPGSEAFSKVAK
SWMNLKSISPSYKTLPSVSETFPTLRSMIEVLNTD
SSPRCL
Storage
-20C
Provider Type Product Number
- No reagents -