HPA018022

TTC13 antibody from Atlas Antibodies
FLJ22584
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018022
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018022, RRID:AB_2211524
Product name
Anti-TTC13
Provider product page
Atlas Antibodies - HPA018022
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EERTQLYHAEIDALYKDLTAKGKVLILSSEFGEAD
AVCNLILSLVYYFYNLMPLSRGSSVIAYSVIVGAL
MASGKEVAGKIPKGKLVDFEAMTAPGSEAFSKVAK
SWMNLKSISPSYKTLPSVSETFPTLRSMIEVLNTD
SSPRCL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -