HPA011223

WNT9A antibody from Sigma-Aldrich
WNT14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011223
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011223, RRID:AB_1858858
Product name
Anti-WNT9A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011223
Antibody type
Polyclonal
Antigen
Protein Wnt-9a precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGS
TTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELV
HLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCG
RGHNTQ
Storage
-20C
Provider Type Product Number
- No reagents -