H00054438-B01P

GFOD1 antibody from Abnova Corporation
ADG-90, C6orf114, FLJ20330

Antibody data

Product number
H00054438-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054438-B01P, RRID:AB_1573715
Product name
GFOD1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00054438-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GFOD1 protein.
Antigen sequence
MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRT
QEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCIN
LPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMT
SAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYV
GEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHS
VGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIK
GIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEF
KQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQ
DATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQ
AFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTI
KRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSR
MSLYC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -