HPA014459

ST6GAL2 antibody from Sigma-Aldrich
KIAA1877, SIAT2, St6gal2, St6GalII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014459, RRID:AB_1857528
Product name
Anti-ST6GAL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014459
Antibody type
Polyclonal
Antigen
Beta-galactoside alpha-2,6-sialyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGL
DARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHK
EFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHT
QGTLGFPSPGEPGPREGAFPAAQ
Storage
-20C
Provider Type Product Number
- No reagents -