Antibody data

Product number
H00085509-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00085509-M08, RRID:AB_1679096
Product name
MBD3L1 monoclonal antibody (M08), clone 1C7
Provider product page
Abnova Corporation - H00085509-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MBD3L1.
Antigen sequence
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTF
KRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRR
LQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSL
LEDL
Isotype
IgG
Antibody clone number
1C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.