Antibody data

Product number
HPA043121
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043121, RRID:AB_2678327
Product name
Anti-MBD3L1
Provider product page
Atlas Antibodies - HPA043121
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTF
KRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRR
LQGLQAYSSAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.