Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405560 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 185 (RNF185) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF185 antibody: synthetic peptide directed towards the middle region of human RNF185
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPP
RPQGQ RPEPENRGGF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A genome annotation-driven approach to cloning the human ORFeome.
Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I
Genome biology 2004;5(10):R84
Genome biology 2004;5(10):R84
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting