Antibody data

Product number
H00002712-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002712-M04, RRID:AB_1204403
Product name
GK2 monoclonal antibody (M04), clone 3G4
Provider product page
Abnova Corporation - H00002712-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GK2.
Antigen sequence
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAEL
LSHHKVELTQEFPKEGWVEQDPKEILQSVYECIAR
TCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTG
EPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSK
TGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALF
GTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI
HSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKT
GALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYG
TGCFLLCNTGRKCVFSEHGLLTTVAYKLGREKPAY
YALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAK
EVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQ
FTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETT
ALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQ
IQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPS
IFSSLPLGFFIVSSMVMLIGARYISGVP
Isotype
IgG
Antibody clone number
3G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -