H00051406-B01P

NOL7 antibody from Abnova Corporation
C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1

Antibody data

Product number
H00051406-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051406-B01P, RRID:AB_1578106
Product name
NOL7 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051406-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NOL7 protein.
Antigen sequence
MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGL
LLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFA
SAQAEAREEERRVRETVRRDKTLLKEKRKRREELF
IEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEV
NLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAV
RLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNK
FLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFK
RRWMVRKMKTKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -